Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQ NISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQ QMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
    • Molecular weight
      17 kDa
    • Amino acids
      1 to 142

Specifications

Our Abpromise guarantee covers the use of ab123836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab123836 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 0.03% EDTA, 10% Glycerol

General Info

  • Alternative names
    • Glia maturation factor gamma
    • Glia maturation factor, gamma
    • GMF GAMMA
    • GMF-gamma
    • Gmfg
    • GMFG_HUMAN
    • MGC126867
    see all
  • Tissue specificity
    Expressed predominantly in lung, heart and placenta.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Information by UniProt

References for Recombinant Human GMFG protein (ab123836)

ab123836 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab123836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up