Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQ NISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQ QMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR
    • Molecular weight
      17 kDa
    • Amino acids
      1 to 142

Associated products

Specifications

Our Abpromise guarantee covers the use of ab123836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab123836 is purified by proprietary chromatographic techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 0.03% EDTA, 10% Glycerol

General Info

  • Alternative names
    • Glia maturation factor gamma
    • Glia maturation factor, gamma
    • GMF GAMMA
    • GMF-gamma
    • Gmfg
    • GMFG_HUMAN
    • MGC126867
    see all
  • Tissue specificity
    Expressed predominantly in lung, heart and placenta.
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family. GMF subfamily.
    Contains 1 ADF-H domain.
  • Information by UniProt

References

ab123836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up