Overview

  • Product nameRecombinant Human GMPR2 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9P2T1
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMPHIDNDVKLDFKDVLLRPKRSTLKSRSEV DLTRSFSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHY SLVQWQEFAGQNPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLDV ANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGI GPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAK AFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAG GVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRR TTFIRVTQQVNPIFSEAC
    • Molecular weight40 kDa including tags
    • Amino acids1 to 348
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab100983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab100983 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 1810008P16Rik
    • 5730544D12Rik
    • AA959850
    • GMP reductase 2
    • GMPR2
    • GMPR2_HUMAN
    • Guanosine 5' monophosphate oxidoreductase 2
    • Guanosine 5''-monophosphate oxidoreductase 2
    • Guanosine monophosphate reductase 2
    • MGC108877
    • MGC15084
    see all
  • FunctionCatalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. Plays a role in modulating cellular differentiation.
  • Tissue specificityHighly expressed in heart, skeletal muscle, kidney, brain, liver, prostate, spleen, placenta, testis and ovary. Low expression in colon, thymus and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the IMPDH/GMPR family.
  • Information by UniProt

Recombinant Human GMPR2 protein images

  • 15% SDS-PAGE showing ab100983 (3 µg) at approximately 40 kDa.

References for Recombinant Human GMPR2 protein (ab100983)

ab100983 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab100983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"