Overview

  • Product name
    Recombinant Human GNA11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGES GKSTFIKQMRIIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKIL YKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPGIQECYDRRRE YQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENII FRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEE SKALFRTIITYPWFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV
    • Amino acids
      1 to 359
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158535 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G alpha-11
    • G-protein subunit alpha-11
    • GA11
    • GNA11
    • GNA11_HUMAN
    • guanine nucleotide binding protein (G protein), alpha 11 (Gq class)
    • Guanine nucleotide-binding protein G(y) subunit alpha
    • Guanine nucleotide-binding protein subunit alpha-11
    • guanine nucleotide-binding protein, alpha 11
    • guanine nucleotide-binding protein, Gq class, GNA11
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Acts as an activator of phospholipase C.
  • Sequence similarities
    Belongs to the G-alpha family. G(q) subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158535 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158535 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158535.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up