Overview

  • Product name
    Recombinant Human GNA14 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRM VDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKA L
    • Amino acids
      150 to 250
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160587 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AU023208
    • g alpha 14
    • G alpha-14
    • G protein alpha subunit 14
    • G protein subunit alpha 14
    • G-protein subunit alpha-14
    • gna14
    • GNA14_HUMAN
    • Guanine nucleotide binding protein (G protein) alpha 14
    • Guanine nucleotide binding protein 14
    • Guanine nucleotide binding protein alpha 14 subunit
    • Guanine nucleotide binding protein subunit alpha 14
    • Guanine nucleotide-binding protein subunit alpha-14
    • MGC105546
    • OTTHUMP00000021515
    • Tieg3
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems.
  • Sequence similarities
    Belongs to the G-alpha family. G(q) subfamily.
  • Information by UniProt

Images

  • ab160587 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160587 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160587.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up