Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEGRSAVVDSVCLESVGFCRSSILAGGQPRWTLAVPGRGSDEVQILEMPS KTSVCALKPKADAKLGMPMCLRLWQADCSSRPLLLAGYEDGSVVLWDVSE QKVCSRIACH
    • Amino acids
      98 to 207
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGCRK3
    • ESTM55
    • fb98e06
    • fj09d12
    • FKSG1
    • G protein subunit beta-like protein 1
    • G-protein beta subunit-like protein
    • GNB1L
    • GNB1L_HUMAN
    • guanine nucleotide binding protein (G protein), beta polypeptide 1-like
    • guanine nucleotide binding protein beta-subunit-like polypeptide
    • Guanine nucleotide-binding protein subunit beta-like protein 1
    • GY2
    • KIAA1645
    • WD repeat-containing protein 14
    • WD40 repeat-containing protein deleted in VCFS
    • WDR14
    • WDVCF
    • wu:fb98e06
    • wu:fj09d12
    • zgc:55774
    see all
  • Tissue specificity
    Ubiquitous. Highly expressed in heart, liver, skeletal muscle, kidney, spleen, thymus and pancreas. Detected at low levels in lung, placenta and brain.
  • Sequence similarities
    Contains 6 WD repeats.
  • Information by UniProt

Images

  • ab162795 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up