Overview

  • Product name
    Recombinant Human GNG10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLV GVPAGSNPFREPRSCALL
    • Amino acids
      1 to 68
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158546 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GBG10_HUMAN
    • GNG10
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3.
  • Tissue specificity
    Abundantly and ubiquitously expressed.
  • Sequence similarities
    Belongs to the G protein gamma family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158546 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158546 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158546.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up