Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPALHIEDLPEKEKLKMEVEQLRKEVKLQRQQVSKCSEEIKNYIEERSGE DPLVKGIPEDKNPFKEKGSCVIS
    • Amino acids
      1 to 73
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein gamma 11 subunit
    • GBG11_HUMAN
    • Gng11
    • GNGT11
    • Guanine nucleotide binding protein G
    • Guanine nucleotide binding protein gamma 11
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
    • IG
    • Osubunit gamma 11 precursor
    • SG
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Tissue specificity
    Abundantly expressed in all tissues tested except for brain.
  • Sequence similarities
    Belongs to the G protein gamma family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158547 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158547.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up