Recombinant Human GNG11 protein (His tag) (ab177606)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMPALHIEDLPEKEKLKMEVEQLRKEVK LQRQQVSKCSEEIKNYIEERSGEDPLVKGIPEDKNPFKEKGSC
    • Molecular weight
      11 kDa including tags
    • Amino acids
      1 to 70
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NP_004117)

Specifications

Our Abpromise guarantee covers the use of ab177606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab177606 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • G protein gamma 11 subunit
    • GBG11_HUMAN
    • Gng11
    • GNGT11
    • Guanine nucleotide binding protein G
    • Guanine nucleotide binding protein gamma 11
    • Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11
    • IG
    • Osubunit gamma 11 precursor
    • SG
    see all
  • Function
    Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.
  • Tissue specificity
    Abundantly expressed in all tissues tested except for brain.
  • Sequence similarities
    Belongs to the G protein gamma family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177606 (3 µg).

References

ab177606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up