Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP22749-2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCP CLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATR VCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGP LGSHHHHHH
    • Molecular weight18 kDa including tags
    • Amino acids1 to 130
    • TagsHis tag N-Terminus
    • Additional sequence informationGNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus).

Specifications

Our Abpromise guarantee covers the use of ab117675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab117675 is purified by proprietary chromatographic techniques.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

  • ReconstitutionIt is recommended to reconstitute in sterile Ultra pure water not less than 100µg/ml, which can then be further diluted into other aqueous solutions. Although stable at room temperature for 3 weeks, ab117675 should be stored desiccated below -18°C. Upon reconstitution ab117675 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

General Info

  • Alternative names
    • 519
    • D2S69E
    • GNLY
    • GNLY_HUMAN
    • Granulysin
    • Granulysin precursor
    • LAG 2
    • LAG2
    • Lymphocyte activation gene 2
    • Lymphokine LAG 2
    • Lymphokine LAG-2
    • NKG 5
    • NKG5
    • Protein NKG5
    • T cell activation protein 519
    • T lymphocyte activation gene 519
    • T-cell activation protein 519
    • TLA519
    see all
  • FunctionAntimicrobial protein that kills intracellular pathogens. Active against a broad range of microbes, including Gram-positive and Gram-negative bacteria, fungi, and parasites. Kills Mycobacterium tuberculosis.
  • Tissue specificityExpressed in natural killer and T-cells.
  • Sequence similaritiesContains 1 saposin B-type domain.
  • Post-translational
    modifications
    A 9 kDa form is produced by proteolytic processing of a 15 kDa protein.
  • Cellular localizationSecreted. Located in the cytotoxic granules of T-cells, which are released upon antigen stimulation.
  • Information by UniProt

References for Recombinant Human GNLY protein (ab117675)

ab117675 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"