Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMKLIILEHYSQASEWAAKYIRNRIIQFNPGPEKYFTLGLPTGSTPLGCYK KLIEY YKNGDLSFKYVKTFNMDEYVGLPRDHPESYHSFMWNNFFKHID IHPENTHILDGN AVDLQAECDAFEEKIKAAGGIELFVGGIGPDGHIAF NEPGSSLVSRTRVKTLAMD TILANARFFDGELTKVPTMALTVGVGTVM DAREVMILITGAHKAFALYKAIEEGV NHMWTVSAFQQHPRTVFVCDED ATLELKVKTVKY

Specifications

Our Abpromise guarantee covers the use of ab88928 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88928 was purified by affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • EC 3.5.99.6
    • GlcN6P deaminase 1
    • Glucosamine 6 phosphate deaminase 1
    • Glucosamine 6 phosphate isomerase 1
    • Glucosamine-6-phosphate deaminase 1
    • Glucosamine-6-phosphate isomerase 1
    • GNPDA 1
    • GNPDA1
    • GNPI
    • GNPI1_HUMAN
    • HLN
    • KIAA0060
    • Oscillin
    • Putative glucosamine 6 phosphate isomerase
    see all
  • FunctionSeems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.
  • Sequence similaritiesBelongs to the glucosamine/galactosamine-6-phosphate isomerase family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

References for Recombinant Human GNPDA1 protein (ab88928)

ab88928 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88928.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"