Recombinant Human GNPDA1 protein (Tagged) (ab190400)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHENLYFQGGEFKLIILEHYSQASEWAAKYIRN RIIQFNPGPEKYFTLGLPTGSTPLGCYKKLIEYYKNGDLSFKYVKTFNMD EYVGLPRDHPESYHSFMWNNFFKHIDIHPENTHILDGNAVDLQAECDAFE EKIKAAGGIELFVGGIGPDGHIAFNEPGSSLVSRTRVKTLAMDTILANAR FFDGELTKVPTMALTVGVGTVMDAREVMILITGAHKAFALYKAIEEGVNH MWTVSAFQQHPRTVFVCDEDATLELKVKTVKYFKGLMLVHNKLVDPLYSI KEKETEKSQSSKKPYSD
    • Molecular weight
      39 kDa including tags
    • Amino acids
      2 to 289
    • Tags
      His-T7 tag N-Terminus
    • Additional sequence information
      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (31aa) fusion at its N-terminal. NP_005462.

Specifications

Our Abpromise guarantee covers the use of ab190400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NACl, EDTA, KCl, arginine, DTT and glycerol

General Info

  • Alternative names
    • EC 3.5.99.6
    • GlcN6P deaminase 1
    • Glucosamine 6 phosphate deaminase 1
    • Glucosamine 6 phosphate isomerase 1
    • Glucosamine-6-phosphate deaminase 1
    • Glucosamine-6-phosphate isomerase 1
    • GNPDA 1
    • GNPDA1
    • GNPI
    • GNPI1_HUMAN
    • HLN
    • KIAA0060
    • Oscillin
    • Putative glucosamine 6 phosphate isomerase
    see all
  • Function
    Seems to trigger calcium oscillations in mammalian eggs. These oscillations serve as the essential trigger for egg activation and early development of the embryo.
  • Sequence similarities
    Belongs to the glucosamine/galactosamine-6-phosphate isomerase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

References

ab190400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up