Recombinant Human GNPNAT1 protein (ab101942)

Overview

  • Product name
    Recombinant Human GNPNAT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMKPDETPMFDPSLLKEVDWSQNTATFS PAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEH MKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDE CRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENY MCRRFLK
    • Molecular weight
      23 kDa including tags
    • Amino acids
      1 to 184
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101942 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101942 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • AU017428
    • AU040593
    • EMeg32
    • FLJ10607
    • Glucosamine 6 phosphate acetyltransferase
    • Glucosamine 6 phosphate N acetyltransferase
    • Glucosamine 6-phosphate N-acetyltransferase
    • Glucosamine phosphate N acetyltransferase 1
    • GNA1
    • GNA1_HUMAN
    • GNPNAT
    • GNPNAT1
    • Gpnat1
    • Gsnpat
    • Phosphoglucosamine acetylase
    • Phosphoglucosamine transacetylase
    • RGD1563144
    see all
  • Pathway
    Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; N-acetyl-alpha-D-glucosamine 1-phosphate from alpha-D-glucosamine 6-phosphate (route I): step 1/2.
  • Sequence similarities
    Belongs to the acetyltransferase family. GNA1 subfamily.
    Contains 1 N-acetyltransferase domain.
  • Cellular localization
    Golgi apparatus membrane. Endosome membrane.
  • Information by UniProt

Recombinant Human GNPNAT1 protein images

  • 15% SDS-PAGE analysis of 3µg ab101942.

References for Recombinant Human GNPNAT1 protein (ab101942)

ab101942 has not yet been referenced specifically in any publications.

Product Wall

I am sorry we can not provide you a free vial for testing however If you wish I can provide you a 100% abreview testing discount code; the code will be worth the price you pay for ab101942.

Full terms and conditions can be found at the followi...

Read More

Thank you for contacting us.

ab101942 protein’s biological activity hasn’t been tested yet, and we can’t give you a specific date on when we will test it. I should mention that it hasn’t been exposed to denaturing agent...

Read More

Thank you for contacting us.

I have contacted laboratory to confirm the activity of the kit. I will send you the details soon.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up