Recombinant Human GOLGA7 protein (ab156974)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMRPQQAPVSGKVFIQRDYSSGTRCQFQ TKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYT IFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITI YEDRGMSSGR
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 137
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156974 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab156974 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 30% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names
    • GCP 16
    • GCP16
    • GOLGA 7
    • GOLGA3AP1
    • GOLGA7A
    • Golgi autoantigen golgin subfamily a 7
    • Golgi complex associated protein of 16kDa
    • Golgin A7
    • Golgin subfamily A member 7
    • HSPC041
    • MGC21096
    • MGC4876
    see all
  • Relevance
    GOLGA7 (Golgi autoantigen, golgin subfamily a, 7) is a member of the golgin family and may be involved in protein transport from the Golgi to the cell surface. GOLGA7 forms a protein complex with ZDHHC9. This ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for H-RAS and N-RAS.
  • Cellular localization
    Golgi apparatus membrane; Lipid-anchor

Images

  • 15% SDS-PAGE analysis of ab156974 (3µg).

References

ab156974 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156974.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up