Recombinant Human GOLGA7 protein (ab162425)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTL NNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQ NEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR
    • Amino acids
      1 to 137
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GCP 16
    • GCP16
    • GOLGA 7
    • GOLGA3AP1
    • GOLGA7A
    • Golgi autoantigen golgin subfamily a 7
    • Golgi complex associated protein of 16kDa
    • Golgin A7
    • Golgin subfamily A member 7
    • HSPC041
    • MGC21096
    • MGC4876
    see all
  • Relevance
    GOLGA7 (Golgi autoantigen, golgin subfamily a, 7) is a member of the golgin family and may be involved in protein transport from the Golgi to the cell surface. GOLGA7 forms a protein complex with ZDHHC9. This ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for H-RAS and N-RAS.
  • Cellular localization
    Golgi apparatus membrane; Lipid-anchor

Images

  • ab162425 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up