Recombinant Human Golgin 97 protein (ab114491)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EKPGPEMANMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLI KAVSVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      668 to 767

Specifications

Our Abpromise guarantee covers the use of ab114491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gap junction protein alpha 4 37kD
    • GOGA1_HUMAN
    • Golga 1
    • GOLGA1
    • Golgi autoantigen golgin subfamily a 1
    • Golgi autoantigen golgin subfamily A member 1
    • Golgi autoantigen golgin subfamily a1.
    • Golgin A1
    • Golgin subfamily A member 1
    • Golgin-97
    • Golgin97
    • MGC33154
    see all
  • Function
    Probably involved in maintaining Golgi structure.
  • Sequence similarities
    Contains 1 GRIP domain.
  • Domain
    Extended rod-like protein with coiled-coil domains.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Recombinant Human Golgin 97 protein images

  • 12.5% SDS-PAGE showing ab114491 at approximately 36.63kDa stained with Coomassie Blue.

References for Recombinant Human Golgin 97 protein (ab114491)

ab114491 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

This is the link I found and which gives you a list of Golgi marker proteins including references and a brief description.

http://www.antibodybeyond.com/reviews/organelle-markers/golgi-marker.htm
<...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up