Recombinant Human Golgin 97 protein (ab114491)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      EKPGPEMANMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLI KAVSVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      668 to 767

Specifications

Our Abpromise guarantee covers the use of ab114491 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 ug/ul.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gap junction protein alpha 4 37kD
    • GOGA1_HUMAN
    • Golga 1
    • GOLGA1
    • Golgi autoantigen golgin subfamily a 1
    • Golgi autoantigen golgin subfamily A member 1
    • Golgi autoantigen golgin subfamily a1.
    • Golgin A1
    • Golgin subfamily A member 1
    • Golgin-97
    • Golgin97
    • MGC33154
    see all
  • Function
    Probably involved in maintaining Golgi structure.
  • Sequence similarities
    Contains 1 GRIP domain.
  • Domain
    Extended rod-like protein with coiled-coil domains.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114491 at approximately 36.63kDa stained with Coomassie Blue.

References

ab114491 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

This is the link I found and which gives you a list of Golgi marker proteins including references and a brief description.

http://www.antibodybeyond.com/reviews/organelle-markers/golgi-marker.htm
<...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up