Recombinant Human GOLPH2 protein (ab153340)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDDY NMDENEAESETDKQAALAGNDRNIDVFNVEDQKRDTINLLDQREKRNHTL
    • Amino acids
      302 to 401
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA379P1.3
    • C9orf155
    • Chromosome 9 open reading frame 155
    • Golgi membrane protein 1
    • Golgi membrane protein GP73
    • Golgi phosphoprotein 2
    • Golgi protein 73 kD
    • Golgi protein 73kD
    • GOLM 1
    • GOLM1
    • GOLM1_HUMAN
    • GOLPH 2
    • GOLPH2
    • GP 73
    • GP73
    • PSEC0257
    see all
  • Function
    Unknown. Cellular response protein to viral infection.
  • Tissue specificity
    Widely expressed. Highly expressed in colon, prostate, trachea and stomach. Expressed at lower level in testis, muscle, lymphoid tissues, white blood cells and spleen. Predominantly expressed by cells of the epithelial lineage. Expressed at low level in normal liver. Expression significantly increases in virus (HBV, HCV) infected liver. Expression does not increase in liver disease due to non-viral causes (alcohol-induced liver disease, autoimmune hepatitis). Increased expression in hepatocytes appears to be a general feature of advanced liver disease. In liver tissue from patients with adult giant-cell hepatitis (GCH), it is strongly expressed in hepatocyte-derived syncitial giant cells. Constitutively expressed by biliary epithelial cells but not by hepatocytes.
  • Sequence similarities
    Belongs to the GOLM1/CASC4 family.
  • Post-translational
    modifications
    Glycosylated.
    Phosphorylation sites are present in the extracelllular medium.
  • Cellular localization
    Golgi apparatus > cis-Golgi network membrane. Early Golgi. Cycles via the cell surface and endosomes upon lumenal pH disruption.
  • Information by UniProt

Images

  • ab153340 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153340 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up