Recombinant Human GOLPH3 protein (ab112422)

Overview

  • Product name
    Recombinant Human GOLPH3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDD DKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALR GRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQ NWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMT THPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLE NAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 298

Specifications

Our Abpromise guarantee covers the use of ab112422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Coat protein
    • Coat protein GPP34
    • FLJ90675
    • Golgi associated protein
    • Golgi peripheral membrane protein 1, 34 kDa
    • Golgi phosphoprotein 3
    • Golgi phosphoprotein 3 (coat protein)
    • Golgi protein
    • GOLP3_HUMAN
    • Golph3
    • GOPP1
    • GPP34
    • MIDAS
    • Mitochondrial DNA absence factor
    see all
  • Function
    Involved in modulation of mTOR signaling. Involved in the regulation of mitochondrial lipids, leading to increase of mitochondrial mass. Potential oncogene.
  • Tissue specificity
    Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
  • Sequence similarities
    Belongs to the GOLPH3/VPS74 family.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Cell membrane. Endosome. Cytoplasm. Golgi apparatus > Golgi stack membrane. Mitochondrion intermembrane space.
  • Information by UniProt

Recombinant Human GOLPH3 protein images

  • ab112422 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human GOLPH3 protein (ab112422)

ab112422 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up