Recombinant Human GOLPH3 protein (ab112422)

Overview

  • Product name
    Recombinant Human GOLPH3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTSLTQRSSGLVQRRTEASRNAADKERAAGGGAGSSEDDAQSRRDEQDDD DKGDSKETRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMLIELALR GRLQLEACGMRRKSLLTRKVICKSDAPTGDVLLDEALKHVKETQPPETVQ NWIELLSGETWNPLKLHYQLRNVRERLAKNLVEKGVLTTEKQNFLLFDMT THPLTNNNIKQRLIKKVQEAVLDKWVNDPHRMDRRLLALIYLAHASDVLE NAFAPLLDEQYDLATKRVRQLLDLDPEVECLKANTNEVLWAVVAAFTK
    • Molecular weight
      59 kDa including tags
    • Amino acids
      1 to 298

Specifications

Our Abpromise guarantee covers the use of ab112422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • Coat protein
    • Coat protein GPP34
    • FLJ90675
    • Golgi associated protein
    • Golgi peripheral membrane protein 1, 34 kDa
    • Golgi phosphoprotein 3
    • Golgi phosphoprotein 3 (coat protein)
    • Golgi protein
    • GOLP3_HUMAN
    • Golph3
    • GOPP1
    • GPP34
    • MIDAS
    • Mitochondrial DNA absence factor
    see all
  • Function
    Involved in modulation of mTOR signaling. Involved in the regulation of mitochondrial lipids, leading to increase of mitochondrial mass. Potential oncogene.
  • Tissue specificity
    Detected in muscle fibers of patients with mitochondrial diseases; not detected in normal muscle fibers.
  • Sequence similarities
    Belongs to the GOLPH3/VPS74 family.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Cell membrane. Endosome. Cytoplasm. Golgi apparatus > Golgi stack membrane. Mitochondrion intermembrane space.
  • Information by UniProt

Images

  • ab112422 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up