Recombinant Human GOLPH4 protein (ab162146)

Overview

  • Product name
    Recombinant Human GOLPH4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HQEQLRQQAHYDAMDNDIVQGAEDQGIQGEEGAYERDNQHQDEAEGDPGN RHEPREQGPREADPESEADRAAVEDINPADDPNNQGEDEFEEAEQV
    • Amino acids
      473 to 568
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162146 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 130 kDa golgi localized phosphoprotein
    • cis
    • cis Golgi localized calcium binding protein
    • GIMPc
    • Golgi integral membrane protein
    • Golgi integral membrane protein 4
    • Golgi phosphoprotein 4
    • Golgi phosphoprotein of 130 kDa
    • Golgi-localized phosphoprotein of 130 kDa
    • GOLI4_HUMAN
    • golim4
    • GOLPH 4
    • GPP 130
    • GPP130
    • P 138
    • P138
    • type II Golgi membrane protein
    see all
  • Function
    Plays a role in endosome to Golgi protein trafficking; mediates protein transport along the late endosome-bypass pathway from the early endosome to the Golgi.
  • Sequence similarities
    Belongs to the GOLIM4 family.
  • Post-translational
    modifications
    Phosphorylated probably by c-AMP-dependent kinases in its lumenal part.
    O-glycosylated; modified by sialic acid residues.
    N-glycosylated; N-glycans are probably of the complex type and modified by sialic acid residues.
  • Cellular localization
    Golgi apparatus > Golgi stack membrane. Endosome membrane. Localizes to cis and medial Golgi cisternae. Probably cycles between early Golgi and distal compartments like endosome.
  • Information by UniProt

Images

  • ab162146 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162146 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162146.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up