Recombinant Human GORASP2 protein (ab153262)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSSQSVEIPGGGTEGYHVLRVQENSPGHRAGLEPFFDFIVSINGSRLNK DNDTLKDLLKANVEKPVKMLIYSSKTLELRETSVTPSNLWGGQGLLGVSI
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153262 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW552058
    • DKFZp434D156
    • FLJ13139
    • Golgi phosphoprotein 6
    • Golgi reassembly stacking protein 2
    • Golgi reassembly stacking protein 2, 55kDa
    • Golgi reassembly stacking protein of 55 kDa
    • Golgi reassembly-stacking protein 2
    • Golgi reassembly-stacking protein of 55 kDa
    • GOLPH2
    • GOLPH6
    • GORASP2
    • GORS2_HUMAN
    • GRASP55
    • GRS2
    • p59
    • RP23-428O15.1
    see all
  • Function
    May be involved in assembly and membrane stacking of the Golgi cisternae, and in the process by which Golgi stacks reform after mitotic breakdown. May regulate the intracellular transport and presentation of a defined set of transmembrane proteins, such as transmembrane TGFA.
  • Sequence similarities
    Belongs to the GORASP family.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications
    Myristoylated. Myristoylation is essential for the Golgi targeting.
    Palmitoylated.
    Phosphorylated in mitotic cells.
  • Cellular localization
    Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab153262 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153262 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153262.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up