Overview

  • Product name
    Recombinant Human GP210 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAARGRGLLLLTLSVLLAAGPSAAAAKLNIPKVLLPFTRATRVNFTLEAS EGCYRWLSTRPEVASIEPLGLDEQQCSQKAVVQARLTQPARLTSIIFAED ITTGQVLRCDAIVDLIHDIQIVSTTRELYLEDSPLELKIQALDSEGNTFS TLAGLVFEWTIVKDSEADRFSDSHNALRILTFLESTYIPPSYISEMEKAA KQGDTILVSGMKTGSSKLKARIQEAVYKNVRPAEVRLLILENILLNPAYD VYLMVGTSIHYKVQKIRQGKITELSMPSDQYELQLQNSIPGPEGDPARPV AVLAQDTSMVTALQLGQSSLVLGHRSIRMQGASRLPNSTIYVVEPGYLGF TVHPGDRWVLETGRLYEITIEVFDKFSNKVYVSDNIRIETVLPAEFFEVL SSSQNGSYHRIRALKRGQTAIDAALTSVVDQDGGVHILQVPVWNQQEVEI HIPITLYPSILTFPWQPKTGAYQYTIRAHGGSGNFSWSSSSHLVATVTVK GVMTTGSDIGFSVIQAHDVQNPLHFGEMKVYVIEPHSMEFAPCQVEARVG QALELPLRISGLMPGGASEVVTLSDCSHFDLAVEVENQGVFQPLPGRLPP GSEHCSGIRVKAEAQGSTTLLVSYRHGHVHLSAKITIAAYLPLKAVDPSS VALVTLGSSKEMLFEGGPRPWILEPSKFFQNVTAEDTDSIGLALFAPHSS RNYQQHWILVTCQALGEQVIALSVGNKPSLTNPFPAVEPAVVKFVCAPPS RLTLAPVYTSPQLDMSCPLLQQNKQVVPVSSHRNPRLDLAAYDQEGRRFD NFSSLSIQWESTRPVLASIEPELPMQLVSQDDESGQKKLHGLQAILVHEA SGTTAITATATGYQESHLSSARTKQPHDPLVPLSASIELILVEDVRVSPE EVTIYNHPGIQAELRIREGSGYFFLNTSTADVVKVAYQEARGVAMVSLGH RSPLLVFIPYLGCCVVN
    • Amino acids
      1 to 967
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22389
    • GP 210
    • KIAA0906
    • Nuclear envelope pore membrane protein POM 210
    • Nuclear pore membrane glycoprotein 210
    • Nuclear pore protein gp210
    • Nucleoporin 210
    • Nucleoporin 210kDa
    • Nucleoporin Nup210
    • Nucleoporin210
    • NUP 210
    • Nup210
    • PO210_HUMAN
    • POM 210
    • POM210
    • Pore membrane protein of 210 kDa
    see all
  • Function
    Nucleoporin essential for nuclear pore assembly and fusion, nuclear pore spacing, as well as structural integrity.
  • Tissue specificity
    Ubiquitous expression, with highest levels in lung, liver, pancreas, testis, and ovary, intermediate levels in brain, kidney, and spleen, and lowest levels in heart and skeletal muscle.
  • Sequence similarities
    Belongs to the NUP210 family.
  • Post-translational
    modifications
    N-glycosylated, but not all potential glycosylation sites may be used. Contains high-mannose type oligosaccharides.
    Phosphorylated at Ser-1881 in mitosis specifically; not phosphorylated in interphase.
  • Cellular localization
    Nucleus > nuclear pore complex. Nucleus membrane. Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab153211 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up