Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDEYALTLGTIDVSYLPHSSEYSVGRCKHTSEEWGECGFRPTIFRSATLK WKESLMSRKRPFVGRCCYSCTPQSWDKFFNTSIPSLGLRNVIYINETHTR HRGWLARRLSYVLFIQERDVHKGMFATNVTENVLNSSRVQEAIAEVAAEL NPDGSAQQQSKAVNKVKKKAKRILQEMVATVSPAMIRLTGWVLLKLFNSF FWNIQIHKGQLEMVKAATETNLPLLFLPVHRSHIDYLLLTFILFCHNIKA PYIASGNNLNIPIFSTLIHKLGGFFIRRRLDETPDGRKDVLYRALLHGHI VELLRQQQFLEIFLEGTRSRSGKTSCARAGLLSVVVDTLSTNVIPDILII PVGISYDRIIEGHYNGEQLGKPKKNESLWSVARGVIRMLRKNYGCVRVDF AQPFSLKEYLESQSQKPVSALLSLEQALLPAILPSRPSDAADEGRDTSIN ESRNATDESLRRRLIANLAEHILFTASKSCAIMSTHIVACLLLYRHRQGI DLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLLGNCVTITHTS RNDEFFITPSTTVPSVFELNFYSNGVLHVFIMEAIIACSLYAVLNKRGLG GPTSTPPNLISQEQLVRKAASLCYLLSNEGTISLPCQTFYQVCHETVGKF IQYGILTVAEHDDQEDISPSLAEQQWDKKLPEPLSWRSDEEDEDSDFGEE QRDCYLKVSQSKEHQQFITFLQRLLGPLLEAYSSAAIFVHNFSGPVPEPE YLQKLHKYLITRTERNVAVYAESATYCLVKNAVKMFKDIGVFKETKQKRV SVLELSSTFLPQCNRQKLLEYILSFVVL
    • Amino acids
      1 to 828
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153459 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glycerol 3 phosphate acyltransferase 1 mitochondrial
    • Glycerol 3 phosphate acyltransferase mitochondrial
    • Glycerol-3-phosphate acyltransferase 1
    • Gpam
    • GPAT
    • GPAT-1
    • GPAT1
    • GPAT1_HUMAN
    • KIAA1560
    • MGC26846
    • mitochondrial
    • RP11-426E5.2
    see all
  • Function
    Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
  • Pathway
    Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 1/3.
  • Sequence similarities
    Belongs to the GPAT/DAPAT family.
  • Domain
    The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate.
  • Cellular localization
    Mitochondrion outer membrane.
  • Information by UniProt

Images

  • ab153459 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153459 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153459.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up