Recombinant Human GPATCH2 protein (ab162961)

Overview

  • Product name
    Recombinant Human GPATCH2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MFGAAGRQPIGAPAAGNSWHFSRTMEELVHDLVSALEESSEQARGGFAET GDHSRSISCPLKRQARKRRGRKRRSYNVHHPWETGHCLSEGSDSSLEEPS KDYRENHNNNKKDHSDSDDQMLVAKRRPSSNLNNNVRGKRPLWHESDFAV DNVGNRTLRRRRKVKRMAVDLPQDISNKRTMTQPPEGCRDQDMDSDRAYQ YQEFTKNKVKKRKLKIIRQAPKIQDEGVVLESEETNQTNKDKMECEEQKV SDELMSESDSSSLSSTDAGLFTNDEGRQGDDEQSDWFYEKESGGACGITG VVPWWEKEDPTELDKNVPDPVFESILTGSFPLMSHPSRRGFQARLSRLHG MSSKNIKKSGGTPTSMATNWTSEIPL
    • Amino acids
      1 to 376
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GPATC2
    • 5830436K05Rik
    • AI427714
    • AI447508
    • AW107440
    • AW491060
    • Cancer/testis antigen 110
    • CT110
    • G patch domain containing 2
    • G patch domain-containing protein 2
    • GPATCH2
    • GPTC2_HUMAN
    • PPP1R30
    • Protein phosphatase 1 regulatory subunit 30
    • RP11 361K17.1
    see all
  • Sequence similarities
    Contains 1 G-patch domain.
  • Information by UniProt

Images

  • ab162961 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up