Recombinant Human GPCR 2037 protein (ab165380)

Overview

  • Product name
    Recombinant Human GPCR 2037 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLAAAFADSNSSSMNVSFAHLHFAGGYLPSDSQDWRTIIPALLVAVCLVG FVGNLCVIGILLHNAWKGKPSMIHSLILNLSLADLSLLLFSAPIRATAYS KSVWDLGWFVCKSSDWFIHTCMAAKSLTIVVVAKVCFMYASDPAKQVSIH NYTIWSVLVAIWTVASLLPLPEWFFSTIRHHEGVEMCLVDVPAVAEEFMS MFGKLYPLLAFGLPLFFASFYFWRAYDQCKKRGTKTQNLRNQIRSKQVTV MLLSIAIISALLWLPEWVAWLWVWHLKAAGPAPPQGFIALSQVLMFSISS ANPLIFLVMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKV PSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQ DNDPIPWEHEDQETGEGVK
    • Amino acids
      1 to 419
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165380 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 151
    • G protein coupled receptor PGR7
    • G-protein coupled receptor PGR7
    • Galanin receptor 4
    • Galanin receptor like
    • GALR4
    • GALRL
    • GP151_HUMAN
    • GPCR
    • GPCR-2037
    • GPCR2037
    • GPR 151
    • Gpr151
    • PGR7
    • Probable G protein coupled receptor 151
    • Probable G-protein coupled receptor 151
    • Putative G protein coupled receptor
    see all
  • Function
    Orphan receptor.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab165380 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165380 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165380.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up