Recombinant Human GPCR EX33 protein (ab162701)

Overview

  • Product name
    Recombinant Human GPCR EX33 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSE PVSAATTQTLEGDSSEVGDQINSKRAKQMAEKSPPEASAKAQPIKGARRA PDSSSEFGK
    • Amino acids
      208 to 316
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162701 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • EX 33
    • EX33
    • G protein coupled receptor 84
    • G protein coupled receptor EX 33
    • G protein coupled receptor EX33
    • G-protein coupled receptor 84
    • GPCR 4
    • GPCR4
    • GPR 84
    • GPR84
    • GPR84_HUMAN
    • Inflammation related G protein coupled receptor EX 33
    • Inflammation related G protein coupled receptor EX33
    • Inflammation-related G-protein coupled receptor EX33
    see all
  • Function
    Receptor for medium-chain free fatty acid (FFA) with carbon chain lengths of C9 to C14. Capric acid (C10:0), undecanoic acid (C11:0) and lauric acid (C12:0) are the most potent agonists. Not activated by short-chain and long-chain saturated and unsaturated FFAs. Activation by medium-chain free fatty acid is coupled to a pertussis toxin sensitive G(i/o) protein pathway. May have important roles in processes from fatty acid metabolism to regulation of the immune system.
  • Tissue specificity
    Expressed predominantly in hematopoietic tissues. High levels detected in the bone marrow and lower levels in the peripheral leukocytes and lung. Also expressed in brain, heart, muscle, colon, thymus, spleen, kidney, liver, placenta and intestine. Within the leukocyte population expression is higher in neutrophils and eosinophils relative to T- or B-lymphocytes.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162701 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162701 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162701.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up