Recombinant Human GPCR GPR12 protein (ab116876)

Overview

  • Product nameRecombinant Human GPCR GPR12 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP47775
    • SpeciesHuman
    • SequenceMNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIV LCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITN FVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHS ERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGV STLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
    • Molecular weight63 kDa including tags
    • Amino acids1 to 334

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ18149
    • FLJ97704
    • G protein coupled receptor 12
    • G-protein coupled receptor 12
    • GPCR12
    • GPCR21
    • GPR 12
    • Gpr12
    • GPR12_HUMAN
    • MGC138349
    • MGC138351
    • Probable G protein coupled receptor GPR12
    see all
  • FunctionPromotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity). Receptor with constitutive G(s) signaling activity that stimulates cyclic AMP production.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human GPCR GPR12 protein images

  • 12.5% SDS-PAGE showing ab116876 at approximately 62.81kDa stained with Coomassie Blue.

References for Recombinant Human GPCR GPR12 protein (ab116876)

ab116876 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"