Recombinant Human GPCR GPR12 protein (ab116876)

Overview

  • Product name
    Recombinant Human GPCR GPR12 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNEDLKVNLSGLPRDYLDAAAAENISAAVSSRVPAVEPEPELVVNPWDIV LCTSGTLISCENAIVVLIIFHNPSLRAPMFLLIGSLALADLLAGIGLITN FVFAYLLQSEATKLVTIGLIVASFSASVCSLLAITVDRYLSLYYALTYHS ERTVTFTYVMLVMLWGTSICLGLLPVMGWNCLRDESTCSVVRPLTKNNAA ILSVSFLFMFALMLQLYIQICKIVMRHAHQIALQHHFLATSHYVTTRKGV STLAIILGTFAACWMPFTLYSLIADYTYPSIYTYATLLPATYNSIINPVI YAFRNQEIQKALCLICCGCIPSSLAQRARSPSDV
    • Molecular weight
      63 kDa including tags
    • Amino acids
      1 to 334

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ18149
    • FLJ97704
    • G protein coupled receptor 12
    • G-protein coupled receptor 12
    • GPCR12
    • GPCR21
    • GPR 12
    • Gpr12
    • GPR12_HUMAN
    • MGC138349
    • MGC138351
    • Probable G protein coupled receptor GPR12
    see all
  • Function
    Promotes neurite outgrowth and blocks myelin inhibition in neurons (By similarity). Receptor with constitutive G(s) signaling activity that stimulates cyclic AMP production.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116876 at approximately 62.81kDa stained with Coomassie Blue.

References

ab116876 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116876.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up