Recombinant Human GPCR GPR17 protein (ab158562)

Overview

  • Product name
    Recombinant Human GPCR GPR17 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNGLEVAPPGLITNFSLATAEQCGQETPLENMLFASFYLLDFILALVGNT LALWFFIRDHKSGTPANVFLMHLAVADLSCVLVLPTRLVYHFSGNHWPFG EIACRLTGFLFYLNMYASIYFLTCISADRFLAIVHPVKSLKLRRPLYAHL ACAFLWVVVAVAMAPLLVSPQTVQTNHTVVCLQLYREKASHHALVSLAVA FTFPFITTVTCYLLIIRSLRQGLRVEKRLKTKAVRMIAIVLAIFLVCFVP YHVNRSVYVLHYRSHGASCATQRILALANRITSCLTSLNGALDPIMYFFV AEKFRHALCNLLCGKRLKGPPPSFEGKTNESSLSAKSEL
    • Amino acids
      1 to 339
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158562 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686M18273
    • G protein coupled receptor 17
    • G-protein coupled receptor 17
    • GPR 17
    • Gpr17
    • GPR17_HUMAN
    • P2Y like receptor
    • P2Y-like receptor
    • Probable P2Y purinoceptor GPR 17
    • Probable P2Y purinoceptor GPR17
    • R12
    • UDP/CysLT receptor
    • Uracil nucleotide/cysteinyl leukotriene receptor
    see all
  • Function
    Dual specificity receptor for uracil nucleotides and cysteinyl leukotrienes (CysLTs). Signals through G(i) and inhibition of adenylyl cyclase. May mediate brain damage by nucleotides and CysLTs following ischemia.
  • Tissue specificity
    Expressed in brain, kidney, heart and umbilical vein endothelial cells. Highest level in brain.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab158562 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158562 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158562.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up