Recombinant Human GPCR GPR48 protein (ab153396)

Overview

  • Product name
    Recombinant Human GPCR GPR48 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCGT QSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVK
    • Amino acids
      852 to 950
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BNMD17
    • G protein coupled receptor 48
    • G-protein coupled receptor 48
    • GPR48
    • Leucine-rich repeat-containing G protein-coupled receptor 4
    • Leucine-rich repeat-containing G-protein coupled receptor 4
    • LGR4
    • LGR4_HUMAN
    see all
  • Function
    Orphan receptor.
  • Tissue specificity
    Expressed in multiple steroidogenic tissues: placenta, ovary, testis and adrenal. Expressed also in spinal cord, thyroid, stomach, trachea, heart, pancreas, kidney, prostate and spleen.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
    Contains 15 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153396 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up