Recombinant Human GPCR GPR85 protein (ab162723)

Overview

  • Product name
    Recombinant Human GPCR GPR85 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MANYSHAADNILQNLSPLTAFLKLTSLGFIIGVSVVGNLLISILLVKDKT LHRAPYYFLLDLCCSDILRSAICFPFVFNSVKNGSTWTYGTLTCKVIAFL GVLSCFHTAFMLFCISVTRYLAIAHHRFYTKRLTFWTCLAVICMVWTLSV AMAFPPVLDVGTYSFIREEDQCAFQHRSFRANDSLGFMLLLALILLATQL VYLKLIFFVHDRRKMKPVQFVAAVSQNWTFHGPGASGQAAANWLAGFGRG PTPPTLLGIRQNANTTGRRRLLVLDEFKMEKRISRMFYIMTFLFLTLWGP YLVACYWRVFARGPVVPGGFLTAAVWMSFAQAGINPFVCIFSNRELRRCF STTLLYCRKSRLPREPYCVI
    • Amino acids
      1 to 370
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162723 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 85
    • GPR 85
    • GPR85
    • Pkrcx1
    • Rgpr85
    • Seven transmembrane helix receptor
    • SREB
    • SREB 2
    • SREB2
    • Super conserved receptor expressed in brain 2
    see all
  • Relevance
    G protein-coupled receptors (GPCRs, or GPRs) contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins. GPCR GPR85 is a member of this family (subfamily Orphan-A). GPCR GPR85 has been reported to be expressed in several areas of human and rat CNS (Matsumoto et al., 2000), as well as in genital organs. ESTs have been isolated from B-cell/lung/testis, brain, testis, and embryo libraries, as well as many mouse tissue libraries.
  • Cellular localization
    Cell Membrane

Images

  • ab162723 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162723 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162723.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up