Recombinant Human GPCR LGR7 protein (ab153471)

Overview

  • Product name
    Recombinant Human GPCR LGR7 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WSMQFDKYFASYYKMTSQYPFEAETPECLVGSVPVQCLCQGLELDCDETN LRAVPSVSSNVTAMSLQWNLIRKLPPDCFKNYHDLQKLYLQNNKI
    • Amino acids
      68 to 162
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153471 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Gm1018
    • Leucine rich repeat containing G protein coupled receptor 7
    • Leucine-rich repeat-containing G-protein coupled receptor 7
    • LGR 7
    • LGR7
    • LGR7.1
    • LGR7.10
    • LGR7.2
    • MGC138347
    • MGC142177
    • Relaxin family peptide receptor 1
    • Relaxin receptor 1
    • Relaxin/insulin like family peptide receptor 1
    • RXFP 1
    • RXFP1
    • RXFP1_HUMAN
    see all
  • Function
    Receptor for relaxins. The activity of this receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP. Binding of the ligand may also activate a tyrosine kinase pathway that inhibits the activity of a phosphodiesterase that degrades cAMP.
  • Tissue specificity
    Expressed in the brain, kidney, testis, placenta, uterus, ovary, adrenal, prostate, skin and heart. Not detected in spleen.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
    Contains 1 LDL-receptor class A domain.
    Contains 9 LRR (leucine-rich) repeats.
    Contains 1 LRRNT domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153471 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153471 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153471.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up