Recombinant Human GPCR TAS1R1 protein (ab153527)

Overview

  • Product name
    Recombinant Human GPCR TAS1R1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVFFESVVLTNLTGKVWVASEAWALSRHITGVPGIQRIGMVLGVAIQKRA VPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKA
    • Amino acids
      281 to 380
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153527 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 70
    • G protein-coupled receptor 70
    • G-protein coupled receptor 70
    • gm 148
    • gm148
    • GPR 70
    • GPR70
    • Krueppel related zinc finger protein 3 (HKR3 protein)
    • seven transmembrane helix receptor
    • Sweet taste receptor T1r
    • T1R1
    • TAS1 R1
    • TAS1R1
    • Taste receptor type 1 member 1
    • taste receptor, type 1, member 1
    • TR 1
    • TR1
    • TS1R1_HUMAN
    see all
  • Function
    Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate). Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 3 family. TAS1R subfamily.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab153527 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153527 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153527.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up