Overview

  • Product nameRecombinant Human GPD1L protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8N335
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAAPLKVCIVGSGNWGSAVAKIIGNNVKK LQKFASTVKMWVFEETVNGRKLTDIINNDHENVKYLPGHKLPENVVAMSN LSEAVQDADLLVFVIPHQFIHRICDEITGRVPKKALGITLIKGIDEGPEG LKLISDIIREKMGIDISVLMGANIANEVAAEKFCETTIGSKVMENGLLFK ELLQTPNFRITVVDDADTVELCGALKNIVAVGAGFCDGLRCGDNTKAAVI RLGLMEMIAFARIFCKGQVSTATFLESCGVADLITTCYGGRNRRVAEAFA RTGKTIEELEKEMLNGQKLQGPQTSAEVYRILKQKGLLDKFPLFTAVYQI CYESRPVQEMLSCLQSHPEHT
    • Molecular weight41 kDa including tags
    • Amino acids1 to 351
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113595 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab113595 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • 2210409H23Rik
    • D9Ertd660e
    • Glycerol 3 phosphate dehydrogenase 1 like
    • Glycerol 3 phosphate dehydrogenase 1 like protein
    • Glycerol-3-phosphate dehydrogenase 1-like protein
    • GPD 1L
    • GPD1-L
    • gpd1l
    • GPD1L_HUMAN
    • KIAA0089
    • RGD1560123
    see all
  • FunctionPlay a role in regulating cardiac sodium current; decreased enzymatic activity with resulting increased levels of glycerol 3-phosphate activating the DPD1L-dependent SCN5A phosphorylation pathway, may ultimately lead to decreased sodium current; cardiac sodium current may also be reduced due to alterations of NAD(H) balance induced by DPD1L.
  • Tissue specificityMost highly expressed in heart tissue, with lower levels in the skeletal muscle, kidney, lung and other organs.
  • Involvement in diseaseDefects in GPD1L are the cause of Brugada syndrome type 2 (BRS2) [MIM:611777]. BRS2 is an autosomal dominant tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset.
    Defects in GPD1L are a cause of sudden infant death syndrome (SIDS) [MIM:272120]. SIDS is the sudden death of an infant younger than 1 year that remains unexplained after a thorough case investigation, including performance of a complete autopsy, examination of the death scene, and review of clinical history. Pathophysiologic mechanisms for SIDS may include respiratory dysfunction, cardiac dysrhythmias, cardiorespiratory instability, and inborn errors of metabolism, but definitive pathogenic mechanisms precipitating an infant sudden death remain elusive.
  • Sequence similaritiesBelongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
  • Cellular localizationCytoplasm. Localized to the region of the plasma membrane.
  • Information by UniProt

Recombinant Human GPD1L protein images

  • 15% SDS-PAGE analysis of ab113595 (3µg)

References for Recombinant Human GPD1L protein (ab113595)

ab113595 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113595.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"