Recombinant Human GPLD1 protein (ab116799)

Overview

  • Product nameRecombinant Human GPLD1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP80108-2
    • SpeciesHuman
    • SequenceMSAFRLWPGLLIMLGSLCHRGSPCGLSTHIEIGHRALEFLQLHNGRVNYR ELLLEHQDAYQAGIVFPDCFYPSICKGGKFHDVSESTHWTPFLNASVHYI RENYPLPWEKDTEKLVAFLFGITSHMAADVSWHSLGLEQGFLRTMGAIDF HGSYSEAHSAGDFGTVYLHLLNFLVV
    • Molecular weight45 kDa including tags
    • Amino acids1 to 176

Specifications

Our Abpromise guarantee covers the use of ab116799 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Glycoprotein phospholipase D
    • Glycosyl-phosphatidylinositol-specific phospholipase D
    • GPI-PLD
    • GPI-specific phospholipase D
    • GPIPLD
    • GPIPLDM
    • GPLD1
    • MGC22590
    • PHLD_HUMAN
    • Phosphatidylinositol glycan specific phospholipase D
    • Phosphatidylinositol-glycan-specific phospholipase D
    • PI-G PLD
    • PIGPLD
    • PIGPLD1
    see all
  • FunctionThis protein hydrolyzes the inositol phosphate linkage in proteins anchored by phosphatidylinositol glycans (GPI-anchor) thus releasing these proteins from the membrane.
  • Sequence similaritiesBelongs to the GPLD1 family.
    Contains 7 FG-GAP repeats.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human GPLD1 protein images

  • 12.5% SDS-PAGE showing ab116799 at approximately 45.47kDa.
    Stained with Coomassie Blue.

References for Recombinant Human GPLD1 protein (ab116799)

ab116799 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us.

This product has not been tested for catalytic activity.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"