Recombinant Human GPR114 protein (ab169904)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEETWEELLSYMENMQVSRGRSSV FSSRQLHQLEQMLLNTSFPGYNLTLQTPTIQSLAFKLSCDFSGLSLTSAT LKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTHFFK DENNSSLLNNYVLGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCVFWK EGARKQPWGGWSPEGCRTEQPSHSQVLCRCNHLTYFAVLMQLSPALVPAE LLAPLTY
    • Molecular weight
      29 kDa including tags
    • Amino acids
      22 to 250
    • Tags
      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169904 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169904 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Contains NaCl, KCl, EDTA, arginine, DTT and glycerol.

General Info

  • Alternative names
    • ADGRG5
    • Adhesion G-protein coupled receptor G5
    • AGRG5_HUMAN
    • G protein coupled receptor 114
    • G-protein coupled receptor 114
    • G-protein coupled receptor PGR27
    • PGR27
    see all
  • Function
    Orphan receptor.
  • Tissue specificity
    Expressed in immune cells. Primarily found in granulocytes. Found in eosinophils.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 2 family. Adhesion G-protein coupled receptor (ADGR) subfamily.
    Contains 1 GPS domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab169904 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169904.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up