Recombinant Human GPR89A protein (ab162565)

Overview

  • Product name
    Recombinant Human GPR89A protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SYFLRNVTDTDILALERRLLQTMDMIISKKKRMAMARRTMFQKGEVHNKP SGFWGMIKSVTTSASGSENLTLIQQEVDALEELSRQLFLETADLYATKER IEYSKTFKGK
    • Amino acids
      175 to 284
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G protein coupled receptor 89A
    • Golgi pH regulator A
    • Golgi pH regulator B
    • GPHR
    • GPR89
    • GPR89B
    • Protein GPR89
    • Putative MAPK activating protein PM01
    • Putative NF kappa B activating protein 90
    • SH120
    • UNQ192
    see all
  • Relevance
    GPR89 is an Orphan-A GPCR with an unknown ligand. There are multiple copies of the sequence G protein-coupled receptor 89 in the human genome. After consultation with the HUGO Gene Nomenclature committee, the symbol GPR89A was assigned to the most centromeric locus and the symbol GPR89B was assigned to the most telomeric locus.
  • Cellular localization
    Golgi Apparatus, membrane.

Images

  • ab162565 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up