Overview

  • Product name
    Recombinant Human GPS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQ ALHPAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK
    • Amino acids
      228 to 327
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AMF 1
    • AMF1
    • G protein pathway suppressor 2
    • GPS 2
  • Relevance
    GPS2(G-protein pathway suppressor 2), also called AMF1, is a human nuclear protein of 327 amino acids involved in G protein-mitogen-activated protein kinase(MAPK) signalling cascades. This protein is an integral subunit of the NCOR1-HDAC3(nuclear receptor corepressor 1-histone deacetylase 3) complex which inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1(activator protein 1) function.
  • Cellular localization
    Nuclear

Images

  • ab158576 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up