Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEASCLELALEGERLCKAGDFKTGVAFFEAAVQVGTEDLKTLSAIYSQLG NAYFYLKEHGRALEYHKHDLLLARTIGDRMGEAKASGNLGNTLKVLGRFD EAAVCCQRHLSIAQEQGDKVGEARALYNIGNVYHAKGKQLSWNAANATQD PGHLPPDVRETLCKASEFYERNLSLVKELGDRAAQGRAYGNLGNTHYLLG NFTEATTFHKERLAIAKEFGDKAAERRAYSNLGNAHVFLGRFDVAAEYYK KTLQLSRQLRDQAVEAQACYSLGNTYTLLQDYERAAEYHLRHLLIAQELA DRVGEGRACWSLGNAYVSMGRPAQALTFAKKHLQISQEIGDRHGELTARM NVAQLQLVLGRLTSPAASEKPDLAGYEAQGEFQGCGGVLLPTGTDRIRSC GGVGSRPGQHGGGGSRQKMAPTSQFFLASGTAQA
    • Amino acids
      1 to 434
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator of G-protein signaling 3
    • AGS3
    • AGS3 homolog
    • C10a
    • G protein signaling modulator 1 (AGS3 like, C. elegans)
    • G-protein-signaling modulator 1
    • GPSM1
    • GPSM1_HUMAN
    see all
  • Function
    Guanine nucleotide dissociation inhibitor (GDI) which functions as a receptor-independent activator of heterotrimeric G-protein signaling. Keeps G(i/o) alpha subunit in its GDP-bound form thus uncoupling heterotrimeric G-proteins signaling from G protein-coupled receptors. Controls spindle orientation and asymmetric cell fate of cerebral cortical progenitors. May also be involved in macroautophagy in intestinal cells. May play a role in drug addiction.
  • Tissue specificity
    Expressed in intestinal cells.
  • Sequence similarities
    Belongs to the GPSM family.
    Contains 4 GoLoco domains.
    Contains 9 TPR repeats.
  • Domain
    The GoLoco domains mediate interaction with G(i/o) alpha (By similarity). The GoLoco domains are essential for the GDI activity toward G(i/o) alpha.
  • Post-translational
    modifications
    Phosphorylation regulates interaction with G(i/o) alpha.
  • Cellular localization
    Cytoplasm > cytosol. Endoplasmic reticulum membrane. Golgi apparatus membrane. Cell membrane.
  • Information by UniProt

Images

  • ab161891 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up