Overview

  • Product name
    Recombinant Human GPSM2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEKVQNWNSEILAKQKPLI AKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDHRIPNSQRKISADTI
    • Amino acids
      381 to 480
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153308 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DFNB82
    • G protein signalling modulator 2
    • G protein signalling modulator 2 (AGS3 like C. elegans)
    • G-protein-signaling modulator 2
    • Gpsm2
    • GPSM2_HUMAN
    • HGNC:29501
    • LGN
    • LGN protein
    • Mosaic protein LGN
    • Pins
    see all
  • Function
    Plays an important role in spindle pole orientation. Interacts and contributes to the functional activity of G(i) alpha proteins. Acts to stabilize the apical complex during neuroblast divisions.
  • Tissue specificity
    Ubiquitously expressed.
  • Involvement in disease
    Defects in GPSM2 are the cause of deafness autosomal recessive type 82 (DFNB82) [MIM:613557]. DFNB82 is a form of non-syndromic deafness characterized by prelingual, bilateral, severe, sensorineural hearing loss. There are no symptoms of vestibular dysfunction.
  • Sequence similarities
    Belongs to the GPSM family.
    Contains 4 GoLoco domains.
    Contains 8 TPR repeats.
  • Cellular localization
    Cytoplasm. Cytoplasm > cell cortex. Localizes in the cytoplasm in the interphase and at cell periphery in the metaphase.
  • Information by UniProt

Images

  • ab153308 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153308 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153308.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up