Overview

  • Product name
    Recombinant Human GPSM3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTAL GPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRP LEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEE QRSRPPTHTC
    • Amino acids
      1 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163758 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Activator of G-protein signaling 4
    • AGS4
    • C6orf9
    • G protein signalling modulator 3 (AGS3 like, C. elegans)
    • G-protein signaling modulator 3 (AGS3-like, C. elegans)
    • G-protein-signaling modulator 3
    • G18
    • G18.1a
    • G18.1b
    • G18.2
    • Gpsm3
    • GPSM3_HUMAN
    • NG1
    • OTTHUMP00000029351
    • Protein G18
    see all
  • Function
    Interacts with subunit of G(i) alpha proteins and regulates the activation of G(i) alpha proteins.
  • Tissue specificity
    Expressed in heart, placenta, lung and liver.
  • Sequence similarities
    Contains 3 GoLoco domains.
  • Domain
    The GoLoco 1 and/or GoLoco 3 domains exhibit GDI activity towards GDP-bound G(i) alpha protein, but not the GoLoco 2 domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab163758 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163758 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163758.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up