Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VRPGGGFVPSFQLFEKGDVNGEKEQKVFSFLKHSCPHPSEILGTFKSISW DPVKVHDIRWNFEKFLVGPDGIPVMRWSHRATVSSVKTDILAYLKQFKTK
    • Amino acids
      122 to 221
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158578 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Arep
    • arMEP24
    • EGLP
    • Epididymal androgen related protein
    • Epididymal secretory glutathione peroxidase
    • epididymis secretory sperm binding protein Li 75p
    • Epididymis specific glutathione peroxidase like protein
    • Epididymis-specific glutathione peroxidase-like protein
    • Glutathione peroxidase 5
    • Glutathione peroxidase 5 (epididymal androgen related protein)
    • Glutathione peroxidase, epididymal
    • GPx-5
    • GPX5
    • GPX5_HUMAN
    • GSHPx-5
    • HEL-S-75p
    • Major androgen regulated protein
    • OTTHUMP00000017919
    • OTTHUMP00000214636
    see all
  • Function
    Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
  • Tissue specificity
    Epididymis.
  • Sequence similarities
    Belongs to the glutathione peroxidase family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab158578 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158578 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158578.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up