Recombinant Human Grancalcin protein (ab103054)

Overview

  • Product nameRecombinant Human Grancalcin protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP28676
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAYPGYGGGFGNFSIQVPGMQMGQPVPETG PAILLDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQS GINGTYSPFSLETCRIMIAMLDRDHTGKMGFNAFKELWAALNAWKENFMT VDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIVKRYSKNGRIFFDDYVA CCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
    • Molecular weight26 kDa including tags
    • Amino acids1 to 217
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103054 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab103054 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • GCA
    • GCL
  • RelevanceGrancalcin is a calcium binding protein abundant in neutrophils and macrophages. It belongs to the penta EF hand subfamily of proteins which includes sorcin, calpain, and ALG2. Grancalcin localization is dependent upon calcium and magnesium. In the absence of divalent cation, grancalcin localizes to the cytosolic fraction; with magnesium alone, it partitions with the granule fraction; and in the presence of magnesium and calcium, it associates with both the granule and membrane fractions, suggesting a role for grancalcin in granule membrane fusion and degranulation.
  • Cellular localization50% cytoplasmic, the remainder being attached to the membranes and granules.

Recombinant Human Grancalcin protein images

  • 15% SDS-PAGE analysis of 3µg ab103054.

References for Recombinant Human Grancalcin protein (ab103054)

ab103054 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103054.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"