Recombinant Human Granzyme A protein (ab114751)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEP TKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGD D
    • Molecular weight
      37 kDa including tags
    • Amino acids
      41 to 141

Specifications

Our Abpromise guarantee covers the use of ab114751 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CTL tryptase
    • CTLA3
    • Cytolytic t cell and natural killer cell specific trypsin like serine protease
    • Cytotoxic T lymphocyte associated serine esterase 3
    • Cytotoxic T lymphocyte proteinase 1
    • Cytotoxic T-lymphocyte proteinase 1
    • Fragmentin 1
    • Fragmentin-1
    • GRAA_HUMAN
    • Granzyme 1 cytotoxic T lymphocyte associated serine esterase 3
    • Granzyme A
    • Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease)
    • Granzyme A (granzyme 1, cytotoxic T lymphocyte associated serine esterase 3)
    • Granzyme A precursor
    • Granzyme-1
    • GZMA
    • H factor
    • Hanukah factor serine protease
    • Hanukkah factor
    • HF
    • HFSP
    • TSP1
    see all
  • Function
    This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Involved in apoptosis.
  • Sequence similarities
    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. Cytoplasmic granule.
  • Information by UniProt

Recombinant Human Granzyme A protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114751 at approximately 36.74kDa.

References for Recombinant Human Granzyme A protein (ab114751)

ab114751 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114751.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up