Recombinant human Granzyme A protein (ab157288)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQV ILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINK YVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKV CNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSF GLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
    • Molecular weight
      52 kDa
    • Amino acids
      29 to 262

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157288 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Specific Activity: ~110U/µg protein. One unit is defined as the amount of enzyme that hydrolyzes 1nmol Z-Lys-SBzl per min. at 25°C in 0.05M TRIS, pH 8.0, containing 0.15M NaCl, 0.01% Triton X-100 and 0.3mM DTNB.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >= 98 % SDS-PAGE.

  • Form
    Liquid
  • Additional notes
    Do not dilute to more than 0.2mg/ml. Do not store dilute solutions (1-1000ng/ml) for more than 24 hours.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 6.00
    Constituents: 0.98% MES, 10% Glycerol, 3.04% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • CTL tryptase
    • CTLA3
    • Cytolytic t cell and natural killer cell specific trypsin like serine protease
    • Cytotoxic T lymphocyte associated serine esterase 3
    • Cytotoxic T lymphocyte proteinase 1
    • Cytotoxic T-lymphocyte proteinase 1
    • Fragmentin 1
    • Fragmentin-1
    • GRAA_HUMAN
    • Granzyme 1 cytotoxic T lymphocyte associated serine esterase 3
    • Granzyme A
    • Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease)
    • Granzyme A (granzyme 1, cytotoxic T lymphocyte associated serine esterase 3)
    • Granzyme A precursor
    • Granzyme-1
    • GZMA
    • H factor
    • Hanukah factor serine protease
    • Hanukkah factor
    • HF
    • HFSP
    • TSP1
    see all
  • Function
    This enzyme is necessary for target cell lysis in cell-mediated immune responses. It cleaves after Lys or Arg. Cleaves APEX1 after 'Lys-31' and destroys its oxidative repair activity. Involved in apoptosis.
  • Sequence similarities
    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. Cytoplasmic granule.
  • Information by UniProt

References

ab157288 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157288.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up