Recombinant Human Granzyme K protein (ab114938)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP49863
    • SpeciesHuman
    • SequenceMTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHH VCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIK KFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCK VTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCA GDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKY QTWIKSNLVPPHTN
    • Molecular weight55 kDa including tags
    • Amino acids1 to 264

Specifications

Our Abpromise guarantee covers the use of ab114938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fragmentin 3
    • Fragmentin-3
    • Fragmentin3
    • GRAK_HUMAN
    • Granzyme 3
    • Granzyme K
    • granzyme K (granzyme 3; tryptase II)
    • granzyme K (serine protease, granzyme 3; tryptase II)
    • Granzyme K precursor
    • Granzyme-3
    • Granzyme3
    • GranzymeK
    • GZMK
    • NK TRYP 2
    • NK TRYP2
    • NK tryptase 2
    • NK-TRYP-2
    • NK-tryptase-2
    • NKTRYP2
    • Serine protease granzyme 3
    • TRYP 2
    • TRYP2
    • Tryptase II
    • TryptaseII
    see all
  • Tissue specificityExpressed in lung, spleen, thymus and peripheral blood leukocytes.
  • Sequence similaritiesBelongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localizationSecreted. Cytoplasmic granule.
  • Information by UniProt

Recombinant Human Granzyme K protein images

  • ab114938 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Granzyme K protein (ab114938)

ab114938 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"