Recombinant Human Granzyme K protein (ab114938)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTKFSSFSLFFLIVGAYMTHVCFNMEIIGGKEVSPHSRPFMASIQYGGHH VCGGVLIDPQWVLTAAHCQYRFTKGQSPTVVLGAHSLSKNEASKQTLEIK KFIPFSRVTSDPQSNDIMLVKLQTAAKLNKHVKMLHIRSKTSLRSGTKCK VTGWGATDPDSLRPSDTLREVTVTVLSRKLCNSQSYYNGDPFITKDMVCA GDAKGQKDSCKGDSGGPLICKGVFHAIVSGGHECGVATKPGIYTLLTKKY QTWIKSNLVPPHTN
    • Molecular weight
      55 kDa including tags
    • Amino acids
      1 to 264

Specifications

Our Abpromise guarantee covers the use of ab114938 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Fragmentin 3
    • Fragmentin-3
    • Fragmentin3
    • GRAK_HUMAN
    • Granzyme 3
    • Granzyme K
    • granzyme K (granzyme 3; tryptase II)
    • granzyme K (serine protease, granzyme 3; tryptase II)
    • Granzyme K precursor
    • Granzyme-3
    • Granzyme3
    • GranzymeK
    • GZMK
    • NK TRYP 2
    • NK TRYP2
    • NK tryptase 2
    • NK-TRYP-2
    • NK-tryptase-2
    • NKTRYP2
    • Serine protease granzyme 3
    • TRYP 2
    • TRYP2
    • Tryptase II
    • TryptaseII
    see all
  • Tissue specificity
    Expressed in lung, spleen, thymus and peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the peptidase S1 family. Granzyme subfamily.
    Contains 1 peptidase S1 domain.
  • Cellular localization
    Secreted. Cytoplasmic granule.
  • Information by UniProt

Images

  • ab114938 on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab114938 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114938.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up