Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO75791
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMEAVAKFDFTASGEDELSFHTGDVLKILSN QEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFF IIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVD YYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRP SMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQ ERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALY DFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR
    • Molecular weight40 kDa including tags
    • Amino acids1 to 330
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab103052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab103052 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, 1mM EDTA, pH 8.0

General Info

  • Alternative names
    • Adapter protein GRID
    • GADS
    • GADS protein
    • GRAP-2
    • Grap2
    • GRAP2_HUMAN
    • GRB-2-like protein
    • GRB2-related adapter protein 2
    • GRB2-related adaptor protein 2
    • GRB2-related protein with insert domain
    • GRB2L
    • GRBLG
    • GRBX
    • Grf-40
    • Grf40
    • Grf40 adapter protein
    • GRID
    • Growth factor receptor-binding protein
    • Growth factor receptor-bound protein 2-related adaptor protein 2
    • GRPL
    • Hema
    • Hematopoietic cell-associated adapter protein GrpL
    • Hematopoietic cell-associated adaptor protein GRPL
    • Mona
    • p38
    • Protein GADS
    • SH3-SH2-SH3 adapter Mona
    • SH3-SH2-SH3 adaptor molecule
    see all
  • FunctionInteracts with SLP-76 to regulate NF-AT activation. Binds to tyrosine-phosphorylated shc.
  • Sequence similaritiesBelongs to the GRB2/sem-5/DRK family.
    Contains 1 SH2 domain.
    Contains 2 SH3 domains.
  • Information by UniProt

Recombinant Human GRAP2 protein images

  • 15% SDS-PAGE analysis of ab103052 (3µg)

References for Recombinant Human GRAP2 protein (ab103052)

ab103052 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab103052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"