Recombinant Human GRASP65 protein (ab112424)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9BQQ3
    • SpeciesHuman
    • SequenceMGLGVSAEQPAGGAEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNK ENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASV RFCSFRRASEQVWHVLDVEPSSPAALAGLRPYTDYVVGSDQILQESEDFF TLIESHEGKPLKLMVYNSKSDSCREVTVTPNAAWGGEGSLGCGIGYGYLH RIPTQPPSYHKKPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSRQ SDYMEALLQAPGSSMEDPLPGPGSPSHSAPDPDGLPHFMETPLQPPPPVQ RVMDPGFLDVSGISLLDNSNASVWPSLPSSTELTTTAVSTSGPEDICSSS SSHERGGEATWSGSEFEVSFLDSPGAQAQADHLPQLTLPDSLTSAASPED GLSAELLEAQAEEEPASTEGLDTGTEAEGLDSQAQISTTE
    • Molecular weight74 kDa including tags
    • Amino acids1 to 440

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • FLJ23443
    • Golgi peripheral membrane protein p65
    • Golgi phosphoprotein 5
    • Golgi reassembly and stacking protein 1
    • Golgi reassembly and stacking protein 65 kDa
    • Golgi reassembly and stacking protein, 65-kD
    • Golgi reassembly stacking protein 1
    • Golgi reassembly stacking protein 1 65kDa
    • Golgi reassembly stacking protein of 65 kDa
    • Golgi reassembly-stacking protein 1
    • Golgi reassembly-stacking protein of 65 kDa
    • GOLPH 5
    • GOLPH5
    • Gorasp 1
    • GORASP1
    • GORS1_HUMAN
    • GRASP 65
    • GRASP65
    • MGC118894
    • MGC118897
    • P65
    see all
  • FunctionStacking factor involved in the postmitotic assembly of Golgi stacks from mitotic Golgi fragments. Key structural protein required for the maintenance of the Golgi apparatus integrity: its caspase-mediated cleavage is required for fragmentation of the Golgi during apoptosis. Also mediates, via its interaction with GM130, the docking of transport vesicles with the Golgi membranes.
  • Sequence similaritiesBelongs to the GORASP family.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications
    Phosphorylated by CDC2/B1 and PLK kinases during mitosis. Phosphorylation cycle correlates with the cisternal stacking cycle. Phosphorylation of the homodimer prevents the association of dimers into higher order oligomers, leading to cisternal unstacking.
    Target for caspase-3 cleavage during apoptosis. The cleavage contributes to Golgi fragmentation and occurs very early in the execution phase of apoptosis.
  • Cellular localizationGolgi apparatus > cis-Golgi network membrane. Undergoes rapid exchange with the cytosol.
  • Information by UniProt

Recombinant Human GRASP65 protein images

  • ab112424 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human GRASP65 protein (ab112424)

ab112424 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"