Recombinant Human Graves disease carrier protein / GDC (ab159936)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGA IQFMAFEHYKTLITTKLGISGHVHR
    • Amino acids
      59 to 133
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159936 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GDA
    • GDC
    • GDC_HUMAN
    • Grave disease autoantigen
    • Graves disease autoantigen
    • Graves disease carrier protein
    • HGT.1
    • hML7
    • Mitochondrial solute carrier protein homolog
    • ML7
    • Slc25a16
    • Solute carrier family 25 member 16
    see all
  • Function
    Required for the accumulation of coenzyme A in the mitochondrial matrix.
  • Sequence similarities
    Belongs to the mitochondrial carrier (TC 2.A.29) family.
    Contains 3 Solcar repeats.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab159936 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159936 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159936.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up