Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MNASLESLYSACSMQSDTVPLLQNGQHARSQPRASGPPRSIQPQVSPRQR VQRSQPVHILAVRRLQEEDQQFRTSSLPAIPNPFPELCGPGSPPVLTPGS LPPSQAAAKQDVKVFSEDGTSKVVEILADMTARDLCQLLVYKSHCVDDNS WTLVEHHPHLGLERCLEDHELVVQVESTMASESKFLFRKNYAKYEFFKNP MNFFPEQMVTWCQQSNGSQTQLLQNFLNSSSCPEIQGFLHVKELGKKSWK KLYVCLRRSGLYCSTKGTSKEPRHLQLLADLEDSNIFSLIAGRKQYNAPT DHGLCIKPNKVRNETKELRLLCAEDEQTRTCWMTAFRLLKYGMLLYQNYR IPQQRKALLSPFSTPVRSVSENSLVAMDFSGQTGRVIENPAEAQSAALEE GHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIK QQGLVDGLFLLRDSQSNPKAFVLTLCHHQKIKNFQILPCEDDGQTFFSLD DGNTKFSDLIQLVDFYQLNKGVLPCKLKHHCIRVAL
    • Molecular weight
      87 kDa including tags
    • Amino acids
      1 to 536
    • Additional sequence information
      This recombinant protein is related to isoform 2 which lacks the first 58 amino acids of the canonical isoform.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152439 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • grb 10
    • GRB IR
    • grb-10
    • GRB10
    • GRB10 adapter protein
    • GRB10 adaptor protein
    • GRB10_HUMAN
    • GRBIR
    • Growth factor receptor bound protein 10
    • Growth factor receptor-bound protein 10
    • Insulin receptor binding protein
    • Insulin receptor binding protein GRB IR
    • Insulin receptor-binding protein Grb-IR
    • IRBP
    • KIAA0207
    • Maternally expressed gene 1
    • MEG1
    • RSS
    see all
  • Function
    Adapter protein which modulates coupling of a number of cell surface receptor kinases with specific signaling pathways. Binds to, and suppress signals from, activated receptors tyrosine kinases, including the insulin (INSR) and insulin-like growth factor (IGF1R) receptors. The inhibitory effect can be achieved by 2 mechanisms: interference with the signaling pathway and increased receptor degradation. Delays and reduces AKT1 phosphorylation in response to insulin stimulation. Blocks association between INSR and IRS1 and IRS2 and prevents insulin-stimulated IRS1 and IRS2 tyrosine phosphorylation. Recruits NEDD4 to IGF1R, leading to IGF1R ubiquitination, increased internalization and degradation by both the proteasomal and lysosomal pathways. May play a role in mediating insulin-stimulated ubiquitination of INSR, leading to proteasomal degradation. Negatively regulates Wnt signaling by interacting with LRP6 intracellular portion and interfering with the binding of AXIN1 to LRP6. Positive regulator of the KDR/VEGFR-2 signaling pathway. May inhibit NEDD4-mediated degradation of KDR/VEGFR-2.
  • Tissue specificity
    Widely expressed in fetal and adult tissues, including fetal and postnatal liver, lung, kidney, skeletal muscle, heart, spleen, skin and brain.
  • Sequence similarities
    Belongs to the GRB7/10/14 family.
    Contains 1 PH domain.
    Contains 1 Ras-associating domain.
    Contains 1 SH2 domain.
  • Domain
    The PH domain binds relatively non-specifically to several phosphoinositides, including PI(5)P, PI(4,5)P2, PI(3,4)P2 and PI(3,4,5)P3, with modest affinities.
  • Post-translational
    modifications
    phosphorylated on serine residues upon EGF, FGF and PDGF stimulation.
  • Cellular localization
    Cytoplasm. When complexed with NEDD4 and IGF1R, follows IGF1R internalization, remaining associated with early endosomes. Uncouples from IGF1R-containing endosomes before the sorting of the receptor to the lysosomal compartment.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152439 stained with Coomassie Blue.

References

ab152439 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152439.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up