Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14451
    • SpeciesHuman
    • SequenceMELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTT GRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASR PHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDETWGLVECHP HLALERGLEDHESVVEVQAAWPVGGDSRFVFRKNFAKYELFKSSPHSLFP EKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRGSGRKLWKRFF CFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQ SRHLHPSCLGSPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQ AWRKKTNHRLSLPMPASGTSLSAAIHRTQLWFHGRISREESQRLIGQQGL VDGLFLVRESQRNPQGFVLSLCHLQKVKHYLILPSEEEGRLYFSMDDGQT RFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL
    • Molecular weight85 kDa including tags
    • Amino acids1 to 532

Specifications

Our Abpromise guarantee covers the use of ab116903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B47
    • Epidermal growth factor receptor GRB 7
    • Epidermal growth factor receptor GRB-7
    • GRB7
    • GRB7 adapter protein
    • GRB7_HUMAN
    • Growth factor receptor bound protein 7
    • Growth factor receptor-bound protein 7
    • OTTHUMP00000164349
    • OTTHUMP00000164350
    • OTTHUMP00000164351
    • OTTHUMP00000164352
    see all
  • FunctionInteracts with the cytoplasmic domain of the epidermal growth factor receptor which is then inhibited. The interaction is mediated by the SH2 domain. Also binds to ERBB2.
  • Sequence similaritiesBelongs to the GRB7/10/14 family.
    Contains 1 PH domain.
    Contains 1 Ras-associating domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues.
  • Information by UniProt

Recombinant Human GRB7 protein images

  • 12.5% SDS-PAGE showing ab116903 at approximately 84.59 kDa stained with Coomassie Blue.

References for Recombinant Human GRB7 protein (ab116903)

ab116903 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"