Recombinant Human GRC5 / PHF2 protein (ab159106)

Overview

  • Product name
    Recombinant Human GRC5 / PHF2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCP NCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CENP-35
    • GRC5
    • JHDM1E
    • Jumonji C domain containing histone demethylase 1E
    • Lysine-specific demethylase PHF2
    • PHD finger protein 2
    • Phf2
    • PHF2_HUMAN
    see all
  • Function
    Lysine demethylase that demethylates both histones and non-histone proteins. Enzymatically inactive by itself, and becomes active following phosphorylation by PKA: forms a complex with ARID5B and mediates demethylation of methylated ARID5B. Demethylation of ARID5B leads to target the PHF2-ARID5B complex to target promoters, where PHF2 mediates demethylation of dimethylated 'Lys-9' of histone H3 (H3K9me2), followed by transcription activation of target genes. The PHF2-ARID5B complex acts as a coactivator of HNF4A in liver. PHF2 is recruited to trimethylated 'Lys-4' of histone H3 (H3K4me3) at rDNA promoters and promotes expression of rDNA.
  • Tissue specificity
    Widely expressed, including in liver (at protein level).
  • Sequence similarities
    Belongs to the JHDM1 histone demethylase family. JHDM1D subfamily.
    Contains 1 JmjC domain.
    Contains 1 PHD-type zinc finger.
  • Domain
    The PHD-type zinc finger mediates the binding to H3K4me2 and H3K4me3.
  • Post-translational
    modifications
    Phosphorylated by PKA on specific serine residues, leading to the formation of an active lysine demethylase complex.
  • Cellular localization
    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab159106 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up