Recombinant Human Gremlin 1 protein (ab112406)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60565
    • SpeciesHuman
    • SequenceKKKGSQGAIPPPDKAQHNDSEQTQSPQQPGSRNRGRGQGRGTAMPGEEVL ESSQEALHVTERKYLKRDWCKTQPLKQTIHEEGCNSRTIINRFCYGQC NS
    • Molecular weight37 kDa including tags
    • Amino acids25 to 124

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112406 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityThis product is useful for Antibody Production and Protein Array
  • Applications

    ELISA

    Western blot

    Peptide Array

    SDS-PAGE

  • FormLiquid
  • Additional notesBest use within three months from the date of receiptThis product is useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced.

General Info

  • Alternative names
    • BMP antagonist 1
    • Cell proliferation inducing gene 2 protein
    • Cell proliferation-inducing gene 2 protein
    • CKTSF1B1
    • colorectal adenoma and carcinoma 1
    • Cysteine knot superfamily 1
    • Cysteine knot superfamily 1, BMP antagonist 1
    • Cysteine knot superfamily BMP antagonist 1
    • DAN domain family member 2
    • DAND2
    • Down regulated in Mos-transformed cells protein
    • Down-regulated in Mos-transformed cells protein
    • DRM
    • grem1
    • GREM1_HUMAN
    • GREMLIN
    • Gremlin 1 homolog, cysteine knot superfamily
    • Gremlin 1 like protein
    • Gremlin 1, cysteine knot superfamily, homolog
    • Gremlin-1
    • Gremlin1
    • IHG-2
    • IHG2
    • Increased in high glucose 2
    • Increased in high glucose protein 2
    • PIG2
    • Proliferation inducing gene 2
    • proliferation inducing gene 2 protein
    see all
  • FunctionCytokine that may play an important role during carcinogenesis and metanephric kidney organogenesis, as a BMP antagonist required for early limb outgrowth and patterning in maintaining the FGF4-SHH feedback loop. Down-regulates the BMP4 signaling in a dose-dependent manner. Acts as inhibitor of monocyte chemotaxis.
  • Tissue specificityHighly expressed in small intestine, fetal brain and colon. Expression is restricted to intestinal subepithelial myofibroblasts (ISEMFs) at the crypt base. In subjects with HMPS1, by contrast, GREM1 is expressed, not only in basal ISEMFs, but also at very high levels in epithelial cells (predominantly colonocytes), with expression extending most of the way up the sides of the crypt. Weakly expressed in brain, ovary, prostate, pancreas and skeletal muscle. In brain found in the region localized around the internal capsule in the large subcortical nuclei, including caudate, putamen, substantia nigra, thalamus and subthalamus. Predominantly expressed in normal cells including neurons, astrocytes and fibroblasts.
  • Involvement in diseasePolyposis syndrome, mixed hereditary 1
  • Sequence similaritiesBelongs to the DAN family.
    Contains 1 CTCK (C-terminal cystine knot-like) domain.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Gremlin 1 protein images

  • Analyis of ab112406 in 12.5% SDS-PAGE (stained with Coomassie Blue)

References for Recombinant Human Gremlin 1 protein (ab112406)

ab112406 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112406.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"